Membrane-bound conformation of a signal peptide: A transferred nuclear overhauser effect analysis

Zhulun Wang, Jeffrey D. Jones, Jose Rizo-Rey, Lila M. Gierasch

Research output: Contribution to journalArticle

66 Citations (Scopus)

Abstract

We have determined the conformation of an analogue of the Escherichia coli LamB signal peptide inserted into a model membrane using the transferred nuclear Overhauser effect (trNOE) NMR technique. In order to make NMR analysis feasible, a water-soluble LamB signal peptide analogue was designed by inserting three basic residues (KRR) into the N-terminal region of the wild-type sequence (with a Val → Trp mutation for fluorescence measurements), viz., MMITLRKRRKLPLAVAVAAGWMSAQAMA-NH2. For the purpose of the trNOE study, the binding affinity of the peptide for phospholipid vesicles was tuned by adjusting the proportion of acidic lipid in the vesicle. Circular dichroism and fluorescence measurements showed that the KRR-LamB signal peptide spontaneously inserted into the lipid bilayer with a conformational transition from a mostly random coil to a predominantly α-helical structure. The trNOE analysis revealed that the α-helix extended from approximately the beginning of the hydrophobic core (residue Leu8) to the C-terminus. The continuity of the helix was somewhat disrupted at the end of the hydrophobic core (around residue Gly17). Furthermore, the topological arrangement of the peptide within the lipid bilayer was explored by NMR line broadening induced by a paramagnetic nitroxide-labeled lipid. The line-broadening results demonstrated that the residues in the helical region are well integrated into the acyl chain region of the bilayer. The N-terminal part of the peptide showed many trNOEs, but without any indication of a helical conformation. The line-broadening analysis indicates that this part of the peptide primarily interacts with the membrane surface.

Original languageEnglish (US)
Pages (from-to)13991-13999
Number of pages9
JournalBiochemistry®
Volume32
Issue number50
StatePublished - 1993

Fingerprint

Protein Sorting Signals
Conformations
Membranes
Peptides
Lipid bilayers
Nuclear magnetic resonance
Lipid Bilayers
Fluorescence
Lipids
Circular Dichroism
Escherichia coli
Phospholipids
Mutation
peptide A
Water

ASJC Scopus subject areas

  • Biochemistry

Cite this

Membrane-bound conformation of a signal peptide : A transferred nuclear overhauser effect analysis. / Wang, Zhulun; Jones, Jeffrey D.; Rizo-Rey, Jose; Gierasch, Lila M.

In: Biochemistry®, Vol. 32, No. 50, 1993, p. 13991-13999.

Research output: Contribution to journalArticle

Wang, Zhulun ; Jones, Jeffrey D. ; Rizo-Rey, Jose ; Gierasch, Lila M. / Membrane-bound conformation of a signal peptide : A transferred nuclear overhauser effect analysis. In: Biochemistry®. 1993 ; Vol. 32, No. 50. pp. 13991-13999.
@article{63cc5e04abd84df4b68e3b7cba0d2456,
title = "Membrane-bound conformation of a signal peptide: A transferred nuclear overhauser effect analysis",
abstract = "We have determined the conformation of an analogue of the Escherichia coli LamB signal peptide inserted into a model membrane using the transferred nuclear Overhauser effect (trNOE) NMR technique. In order to make NMR analysis feasible, a water-soluble LamB signal peptide analogue was designed by inserting three basic residues (KRR) into the N-terminal region of the wild-type sequence (with a Val → Trp mutation for fluorescence measurements), viz., MMITLRKRRKLPLAVAVAAGWMSAQAMA-NH2. For the purpose of the trNOE study, the binding affinity of the peptide for phospholipid vesicles was tuned by adjusting the proportion of acidic lipid in the vesicle. Circular dichroism and fluorescence measurements showed that the KRR-LamB signal peptide spontaneously inserted into the lipid bilayer with a conformational transition from a mostly random coil to a predominantly α-helical structure. The trNOE analysis revealed that the α-helix extended from approximately the beginning of the hydrophobic core (residue Leu8) to the C-terminus. The continuity of the helix was somewhat disrupted at the end of the hydrophobic core (around residue Gly17). Furthermore, the topological arrangement of the peptide within the lipid bilayer was explored by NMR line broadening induced by a paramagnetic nitroxide-labeled lipid. The line-broadening results demonstrated that the residues in the helical region are well integrated into the acyl chain region of the bilayer. The N-terminal part of the peptide showed many trNOEs, but without any indication of a helical conformation. The line-broadening analysis indicates that this part of the peptide primarily interacts with the membrane surface.",
author = "Zhulun Wang and Jones, {Jeffrey D.} and Jose Rizo-Rey and Gierasch, {Lila M.}",
year = "1993",
language = "English (US)",
volume = "32",
pages = "13991--13999",
journal = "Biochemistry",
issn = "0006-2960",
publisher = "American Chemical Society",
number = "50",

}

TY - JOUR

T1 - Membrane-bound conformation of a signal peptide

T2 - A transferred nuclear overhauser effect analysis

AU - Wang, Zhulun

AU - Jones, Jeffrey D.

AU - Rizo-Rey, Jose

AU - Gierasch, Lila M.

PY - 1993

Y1 - 1993

N2 - We have determined the conformation of an analogue of the Escherichia coli LamB signal peptide inserted into a model membrane using the transferred nuclear Overhauser effect (trNOE) NMR technique. In order to make NMR analysis feasible, a water-soluble LamB signal peptide analogue was designed by inserting three basic residues (KRR) into the N-terminal region of the wild-type sequence (with a Val → Trp mutation for fluorescence measurements), viz., MMITLRKRRKLPLAVAVAAGWMSAQAMA-NH2. For the purpose of the trNOE study, the binding affinity of the peptide for phospholipid vesicles was tuned by adjusting the proportion of acidic lipid in the vesicle. Circular dichroism and fluorescence measurements showed that the KRR-LamB signal peptide spontaneously inserted into the lipid bilayer with a conformational transition from a mostly random coil to a predominantly α-helical structure. The trNOE analysis revealed that the α-helix extended from approximately the beginning of the hydrophobic core (residue Leu8) to the C-terminus. The continuity of the helix was somewhat disrupted at the end of the hydrophobic core (around residue Gly17). Furthermore, the topological arrangement of the peptide within the lipid bilayer was explored by NMR line broadening induced by a paramagnetic nitroxide-labeled lipid. The line-broadening results demonstrated that the residues in the helical region are well integrated into the acyl chain region of the bilayer. The N-terminal part of the peptide showed many trNOEs, but without any indication of a helical conformation. The line-broadening analysis indicates that this part of the peptide primarily interacts with the membrane surface.

AB - We have determined the conformation of an analogue of the Escherichia coli LamB signal peptide inserted into a model membrane using the transferred nuclear Overhauser effect (trNOE) NMR technique. In order to make NMR analysis feasible, a water-soluble LamB signal peptide analogue was designed by inserting three basic residues (KRR) into the N-terminal region of the wild-type sequence (with a Val → Trp mutation for fluorescence measurements), viz., MMITLRKRRKLPLAVAVAAGWMSAQAMA-NH2. For the purpose of the trNOE study, the binding affinity of the peptide for phospholipid vesicles was tuned by adjusting the proportion of acidic lipid in the vesicle. Circular dichroism and fluorescence measurements showed that the KRR-LamB signal peptide spontaneously inserted into the lipid bilayer with a conformational transition from a mostly random coil to a predominantly α-helical structure. The trNOE analysis revealed that the α-helix extended from approximately the beginning of the hydrophobic core (residue Leu8) to the C-terminus. The continuity of the helix was somewhat disrupted at the end of the hydrophobic core (around residue Gly17). Furthermore, the topological arrangement of the peptide within the lipid bilayer was explored by NMR line broadening induced by a paramagnetic nitroxide-labeled lipid. The line-broadening results demonstrated that the residues in the helical region are well integrated into the acyl chain region of the bilayer. The N-terminal part of the peptide showed many trNOEs, but without any indication of a helical conformation. The line-broadening analysis indicates that this part of the peptide primarily interacts with the membrane surface.

UR - http://www.scopus.com/inward/record.url?scp=0027769981&partnerID=8YFLogxK

UR - http://www.scopus.com/inward/citedby.url?scp=0027769981&partnerID=8YFLogxK

M3 - Article

C2 - 8268177

AN - SCOPUS:0027769981

VL - 32

SP - 13991

EP - 13999

JO - Biochemistry

JF - Biochemistry

SN - 0006-2960

IS - 50

ER -